From reference to formula.Free perfume formulation app.Work with these materials in PerfuMate.Start a formula, free

Catalog › Herbal › 3-Methyl-2,4-nonanedione

3-Methyl-2,4-nonanedione

CAS 113486-29-6  ·  Synthetic  ·  Heart note  ·  Hay and tea, anisic

Impact

9 of 10

Working dilution

0.1% what we prefill
Herbal 50%Spicy 25%Gourmand 17%Green 8%
anisic 75%caramel 17%herbal 8%

What does 3-Methyl-2,4-nonanedione smell like?

Bedoukian's own FL-841 spec sheet gives a sweet hay character reminiscent of green and black tea, with cream notes appearing at lower levels and dry green notes that carry dried herbs. Perfumer & Flavorist list BRI 841 in the 2026 fragrance range as anisic, spicy, herbal, green and lactonic, and TGSC records fruity, straw, caramel and burnt at 10% in dipropylene glycol. It is among the most powerful odorants known, an aroma determinant of tea, apricot and oxidised wine detectable at parts per trillion, with the receptor OR1A1 highly selective for it. In a formula a trace builds hay, tea and tobacco character or lends anisic-lactonic warmth to a gourmand; an overdose turns burnt and prune-like and will swallow everything around it, so weigh it only from a very dilute solution.

herbaldrysweetgreenspicymilkytenacious

Use 3-Methyl-2,4-nonanedione in a formula

What else is 3-Methyl-2,4-nonanedione called?

3-Methylnonane-2,4-dione  ·  MND  ·  BRI 841

Work out a 0.1% dilution of 3-Methyl-2,4-nonanedione with the free dilution calculator

What can replace 3-Methyl-2,4-nonanedione?

Computed, not collected from forums. A pair covers together what one cannot. The number is how much of this material's character a bottle carries, not a promise that it is the same thing.

  • Poivre Piqué DL 76% + 5-Hydroxymethylfurfural 24% closer in spirit than in chemistry
    carries Anisic spicy, Caramel gourmand. Anisic herbal; Herbal green; Poivre Piqué DL brings the Black pepper spicy side (76%); 5-Hydroxymethylfurfural brings the Caramel gourmand side (24%)
    57%
  • Poivre Piqué DL closer in spirit than in chemistry
    carries Anisic herbal, Anisic spicy. Caramel gourmand; Herbal green
    51%
  • Toscanol 63% + Poivre Piqué DL 37% closer in spirit than in chemistry
    carries Anisic herbal, Anisic spicy. Caramel gourmand; Herbal green; Toscanol brings the Anisic herbal side (63%); Poivre Piqué DL brings the Black pepper spicy side (37%); softer, so use a little more
    55%
  • Toscanol 82% + 5-Hydroxymethylfurfural 19% closer in spirit than in chemistry
    carries Anisic spicy. Anisic herbal; Caramel gourmand; Herbal green; Toscanol brings the Anisic herbal side (82%); 5-Hydroxymethylfurfural brings the Caramel gourmand side (18%); softer, so use a little more
    55%
  • Poivre Piqué DL 63% + Spicyrup 38% closer in spirit than in chemistry
    carries Anisic spicy. Anisic herbal; Caramel gourmand; Herbal green; Poivre Piqué DL brings the Black pepper spicy side (62%); Spicyrup brings the Caramel gourmand side (38%); lasts about 2.1x longer on paper
    54%

Try the swap on your own shelf How to substitute a perfume material

Which materials are closest to 3-Methyl-2,4-nonanedione?

Ranked by shared olfactive sub-categories, not alphabetically.

How much does PerfuMate know about one material?

Counted from the file the app ships, the moment this page was built.

3-Methyl-2,4-nonanedione

A written odor description
yes
Olfactive families, in dominance order
4
Sub-categories under them
3
Impact, out of 10
9
Hours on a blotter
estimated from family and band
CAS number
yes
Supplier and trade synonyms
3
Constituent breakdown
not on file

All 2,211 materials

Described in words
every one
Impact rating out of 10
2125
Classified into an olfactive family
2,172
Carrying several families, in order
2,070
Sub-category assignments
9,899 across 229 pairs
A top / heart / base band
2,157
Hours on a blotter
898
CAS number
1,642
Supplier synonyms
5,888 names
Constituent breakdowns
739

Every regulatory join - IFRA, GHS, allergens - is by CAS number, and a material can supply one through its constituents as well as its own row, so of the 569 materials carrying no CAS number the 244 without a constituent table are the ones that return "nothing known" rather than "nothing applies". The blotter hours are sourced rather than measured by us, and the app labels every one of them an estimate. There is no physical chemistry on a row: no molecular weight, no vapour pressure, no boiling point. The longer answer, or the whole catalog counted.