PerfuMate Open the bench

This catalog is better on the bench.Adopt any material and build with it.Open the bench, free ›

CatalogHerbal › 3-Methyl-2,4-nonanedione

3-Methyl-2,4-nonanedione

CAS 113486-29-6  ·  Synthetic  ·  Heart note  ·  Hay and tea, anisic
Herbal 50%Spicy 25%Gourmand 17%Green 8%
herbal 58%spicy 25%gourmand 17%

What does 3-Methyl-2,4-nonanedione smell like?

Bedoukian's own FL-841 spec sheet gives a sweet hay character reminiscent of green and black tea, with cream notes appearing at lower levels and dry green notes that carry dried herbs. Perfumer & Flavorist list BRI 841 in the 2026 fragrance range as anisic, spicy, herbal, green and lactonic, and TGSC records fruity, straw, caramel and burnt at 10% in dipropylene glycol. It is among the most powerful odorants known, an aroma determinant of tea, apricot and oxidised wine detectable at parts per trillion, with the receptor OR1A1 highly selective for it. In a formula a trace builds hay, tea and tobacco character or lends anisic-lactonic warmth to a gourmand; an overdose turns burnt and prune-like and will swallow everything around it, so weigh it only from a very dilute solution.

herbaldrysweetgreenspicymilkytenacious

Impact

9 of 10

Typical dilution

0.1% in solvent

What else is 3-Methyl-2,4-nonanedione called?

3-Methylnonane-2,4-dione  ·  MND  ·  BRI 841

What can replace 3-Methyl-2,4-nonanedione?

Computed, not collected from forums. A pair covers together what one cannot. The number is the engine's match, not a promise.

Try the swap on your own shelf

Which materials are closest to 3-Methyl-2,4-nonanedione?

Ranked by shared olfactive sub-categories, not alphabetically.

How much does PerfuMate know about one material?

Counted from the file the app ships, the moment this page was built.

3-Methyl-2,4-nonanedione

A written odor description
yes
Olfactive families, in dominance order
4
Sub-categories under them
3
Impact, out of 10
9
Hours on a blotter
estimated from family and band
CAS number
yes
Supplier and trade synonyms
3
Constituent breakdown
not on file

All 2,027 materials

Described in words
every one
Impact rating out of 10
every one
Classified into an olfactive family
1,989
Carrying several families, in order
1,893
Sub-category assignments
7,409 across 214 pairs
A top / heart / base band
1,974
Hours on a blotter
441
CAS number
1,487
Supplier synonyms
5,222 names
Constituent breakdowns
667

Every regulatory join - IFRA, GHS, allergens - is by CAS number, and a material can supply one through its constituents as well as its own row, so of the 540 materials carrying no CAS number the 248 without a constituent table are the ones that return "nothing known" rather than "nothing applies". The blotter hours are sourced rather than measured by us, and the app labels every one of them an estimate. There is no physical chemistry on a row: no molecular weight, no vapour pressure, no boiling point. The longer answer, or the whole catalog counted.

Open 3-Methyl-2,4-nonanedione on your bench